PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG024910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YA
Protein Properties Length: 227aa    MW: 25064.2 Da    PI: 9.8931
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG024910.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA101.11.1e-3171127158
    CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                  d p+YVNaKQy++I++RRq+Rakle+++kl  k+rkpylheSRh hAl+R RgsgGrF
  CCG024910.1  71 DGPIYVNAKQYRGIIRRRQSRAKLEAQNKL-VKNRKPYLHESRHIHALNRVRGSGGRF 127
                  57****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005215.0E-3569130IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115234.86970130IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006166.8E-237395IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.1E-2773127IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS0068607595IPR018362CCAAT-binding factor, conserved site
PRINTSPR006166.8E-23104127IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MKPVLLLSTP DSVSNHSQAD CSYSMVRAPH ADPYFGGLFN PYELHAFPHL GSHMVGMTAG  60
RVPLPVDLAD DGPIYVNAKQ YRGIIRRRQS RAKLEAQNKL VKNRKPYLHE SRHIHALNRV  120
RGSGGRFLSK KKLQESDPTP SQCNVTDTIH SHVKNDASEL ESYQSGTGQS GASNTTCSDI  180
TSVSYSNVTF RQPERRFSGI ATHLGGGMEI NSRLICRGTQ HHTSVVQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A2e-2071132263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2130150.0AC213015.1 Populus trichocarpa clone POP034-G19, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011003464.11e-170PREDICTED: nuclear transcription factor Y subunit A-3-like isoform X2
TrEMBLB9INA81e-165B9INA8_POPTR; Uncharacterized protein
STRINGPOPTR_0018s07220.11e-165(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF69493149
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G72830.14e-51nuclear factor Y, subunit A3